PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.E03955.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 78aa    MW: 8961.58 Da    PI: 11.477
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.E03955.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF762.8e-241360451
                    -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    ++   rqv f kRr+g++KKA+ELS LCdaev +++fs+ gklyeyss
  Pahal.E03955.2 13 QDRLSRQVRFFKRRTGLFKKAFELSLLCDAEVVLLVFSPAGKLYEYSS 60
                    67889*****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-27261IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.717262IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-25424IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.14E-24462IPR002100Transcription factor, MADS-box
PfamPF003195.9E-221458IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-252439IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-253960IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 78 aa     Download sequence    Send to blast
MAPRGRVQLR RFQDRLSRQV RFFKRRTGLF KKAFELSLLC DAEVVLLVFS PAGKLYEYSS  60
SASFILALDC ARQMKRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D3e-16461259Myocyte-specific enhancer factor 2A
3mu6_C3e-16461259Myocyte-specific enhancer factor 2A
3mu6_B3e-16461259Myocyte-specific enhancer factor 2A
3mu6_A3e-16461259Myocyte-specific enhancer factor 2A
3p57_J4e-16461259Myocyte-specific enhancer factor 2A
3p57_I4e-16461259Myocyte-specific enhancer factor 2A
3p57_D4e-16461259Myocyte-specific enhancer factor 2A
3p57_C4e-16461259Myocyte-specific enhancer factor 2A
3p57_B4e-16461259Myocyte-specific enhancer factor 2A
3p57_A4e-16461259Myocyte-specific enhancer factor 2A
3kov_J4e-16461259Myocyte-specific enhancer factor 2A
3kov_I4e-16461259Myocyte-specific enhancer factor 2A
3kov_B4e-16461259Myocyte-specific enhancer factor 2A
3kov_A4e-16461259Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1848191e-60KF184819.1 Saccharum hybrid cultivar R570 clone BAC 004J16 complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001140218.14e-31putative MADS-box transcription factor family protein
SwissprotQ388381e-23AGL14_ARATH; Agamous-like MADS-box protein AGL14
TrEMBLB4FML14e-31B4FML1_MAIZE; MADS transcription factor
STRINGGRMZM2G171650_P051e-30(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30260.11e-25AGAMOUS-like 79